PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla005053
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family LBD
Protein Properties Length: 202aa    MW: 22001.1 Da    PI: 6.4888
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla005053genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.54.6e-43381371100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++kll++lp+++r da+sslvyeA ar+rdPvyG++g i +lq+q+++l+aela++++e
  Cla005053  38 PCAACKILRRRCAEKCVLAPYFPPSDPLKFTIAHRVFGASNIIKLLQDLPDSQRADAVSSLVYEASARIRDPVYGCAGAICQLQKQINELQAELAKTQAE 137
                7***********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.75737138IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4238135IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MESSEPKSSP TSTNLLSQSS PSSPSPPPSV QAAVVVSPCA ACKILRRRCA EKCVLAPYFP  60
PSDPLKFTIA HRVFGASNII KLLQDLPDSQ RADAVSSLVY EASARIRDPV YGCAGAICQL  120
QKQINELQAE LAKTQAELVN IHCHQANLVA LICKELAQTP PPMSPLPDHR SLDNNFNIAT  180
PQSYQGYTSL FEDSNIWDPL WT
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819281e-152LN681928.1 Cucumis melo genomic scaffold, anchoredscaffold00004.
GenBankLN7132661e-152LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008463550.11e-128PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR02e-68LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK084e-68LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0A0LS551e-101A0A0A0LS55_CUCSA; Uncharacterized protein
STRINGVIT_06s0004g03330.t013e-82(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-65LOB domain-containing protein 1